SCOPe 2.07: Domain d1tljb_: 1tlj B:

Lineage for d1tljb_ (1tlj B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.282: SSo0622-like [111277] (1 superfamily)
   alpha(2)-beta(2)-alpha-beta-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel beta-sheet: order 21354; strands 1,3 and 5 and the C-terminal helix are longer than other secondary structures

4. Superfamily d.282.1: SSo0622-like [111278] (1 family)
   the dimer, formed in the crystals, is a probable biological unit
   automatically mapped to Pfam PF02676

5. Family d.282.1.1: SSo0622-like [111279] (1 protein)
   Pfam PF02676

6. Protein Hypothetical protein SSo0622 [111280] (1 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [111281] (1 PDB entry)
   Uniprot Q9UX16

8. Domain d1tljb_: 1tlj B: [107127]
   Structural genomics target
   complexed with so4

Details for d1tljb_

PDB Entry: 1tlj, 2.8 Å

PDB Description: crystal structure of conserved protein of unknown function sso0622 from sulfolobus solfataricus

PDB Compounds: (B:) Hypothetical UPF0130 protein SSO0622

SCOPe Domain Sequences for d1tljb_:

Sequence; same for both SEQRES and ATOM records:

>d1tljb_ d.282.1.1 (B:) Hypothetical protein SSo0622 {Sulfolobus solfataricus [TaxId: 2287]}
vweelrekalnkiyhdkeigyldpdilgfllafyrnrndvytqsscsgritivdaempwd
rknstiifknhlriteqdledvlsknqvrrlwlivqgpiihiyaknietgwdilkiarea
gfkhsgilatnqkgvlvelrtgirmvhllresntervdkdkiktlvnvcnevlargkqkm
nllkdlls

Timeline for d1tljb_:

• d1tljb_ first appeared in SCOP 1.69
  
• d1tljb_ appears in SCOPe 2.06
  
• d1tljb_ appears in the current release, SCOPe 2.08