Lineage for d1tljb_ (1tlj B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009646Fold d.282: SSo0622-like [111277] (1 superfamily)
    alpha(2)-beta(2)-alpha-beta-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel beta-sheet: order 21354; strands 1,3 and 5 and the C-terminal helix are longer than other secondary structures
  4. 3009647Superfamily d.282.1: SSo0622-like [111278] (1 family) (S)
    the dimer, formed in the crystals, is a probable biological unit
    automatically mapped to Pfam PF02676
  5. 3009648Family d.282.1.1: SSo0622-like [111279] (1 protein)
    Pfam PF02676
  6. 3009649Protein Hypothetical protein SSo0622 [111280] (1 species)
  7. 3009650Species Sulfolobus solfataricus [TaxId:2287] [111281] (1 PDB entry)
    Uniprot Q9UX16
  8. 3009652Domain d1tljb_: 1tlj B: [107127]
    Structural genomics target
    complexed with so4

Details for d1tljb_

PDB Entry: 1tlj (more details), 2.8 Å

PDB Description: crystal structure of conserved protein of unknown function sso0622 from sulfolobus solfataricus
PDB Compounds: (B:) Hypothetical UPF0130 protein SSO0622

SCOPe Domain Sequences for d1tljb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tljb_ d.282.1.1 (B:) Hypothetical protein SSo0622 {Sulfolobus solfataricus [TaxId: 2287]}
vweelrekalnkiyhdkeigyldpdilgfllafyrnrndvytqsscsgritivdaempwd
rknstiifknhlriteqdledvlsknqvrrlwlivqgpiihiyaknietgwdilkiarea
gfkhsgilatnqkgvlvelrtgirmvhllresntervdkdkiktlvnvcnevlargkqkm
nllkdlls

SCOPe Domain Coordinates for d1tljb_:

Click to download the PDB-style file with coordinates for d1tljb_.
(The format of our PDB-style files is described here.)

Timeline for d1tljb_: