![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.282: SSo0622-like [111277] (1 superfamily) alpha(2)-beta(2)-alpha-beta-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel beta-sheet: order 21354; strands 1,3 and 5 and the C-terminal helix are longer than other secondary structures |
![]() | Superfamily d.282.1: SSo0622-like [111278] (1 family) ![]() the dimer, formed in the crystals, is a probable biological unit automatically mapped to Pfam PF02676 |
![]() | Family d.282.1.1: SSo0622-like [111279] (1 protein) Pfam PF02676 |
![]() | Protein Hypothetical protein SSo0622 [111280] (1 species) |
![]() | Species Sulfolobus solfataricus [TaxId:2287] [111281] (1 PDB entry) Uniprot Q9UX16 |
![]() | Domain d1tlja_: 1tlj A: [107126] Structural genomics target complexed with so4 |
PDB Entry: 1tlj (more details), 2.8 Å
SCOPe Domain Sequences for d1tlja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tlja_ d.282.1.1 (A:) Hypothetical protein SSo0622 {Sulfolobus solfataricus [TaxId: 2287]} lvweelrekalnkiyhdkeigyldpdilgfllafyrnrndvytqsscsgritivdaempw drknstiifknhlriteqdledvlsknqvrrlwlivqgpiihiyaknietgwdilkiare agfkhsgilatnqkgvlvelrtgirmvhllresntervdkdkiktlvnvcnevlargkqk mnllkdlls
Timeline for d1tlja_: