Lineage for d1tlbu_ (1tlb U:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008710Fold d.248: Coproporphyrinogen III oxidase [102885] (2 superfamilies)
    alpha-beta(6)-alpha(2)-beta-alpha(n); 3 layers alpha/beta/alpha; antiparallel sheet: order 1234567
  4. 3008711Superfamily d.248.1: Coproporphyrinogen III oxidase [102886] (2 families) (S)
    automatically mapped to Pfam PF01218
  5. 3008712Family d.248.1.1: Coproporphyrinogen III oxidase [102887] (3 proteins)
    Pfam PF01218
  6. 3008713Protein Coproporphyrinogen III oxidase [110896] (1 species)
  7. 3008714Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110897] (4 PDB entries)
    Uniprot P11353
  8. 3008721Domain d1tlbu_: 1tlb U: [107124]
    complexed with so4

Details for d1tlbu_

PDB Entry: 1tlb (more details), 2.4 Å

PDB Description: Yeast coproporphyrinogen oxidase
PDB Compounds: (U:) Coproporphyrinogen III oxidase

SCOPe Domain Sequences for d1tlbu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tlbu_ d.248.1.1 (U:) Coproporphyrinogen III oxidase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
apqdprnlpirqqmealirrkqaeitqglesidtvkfhadtwtrgndggggtsmviqdgt
tfekggvnvsvvygqlspaavsamkadhknlrlpedpktglpvtdgvkffacglsmvihp
vnphaptthlnyryfetwnqdgtpqtwwfgggadltpsylyeedgqlfhqlhkdaldkhd
talyprfkkwcdeyfyithrketrgiggiffddyderdpqeilkmvedcfdaflpsylti
vkrrkdmpytkeeqqwqairrgryvefnliydrgtqfglrtpgsrvesilmslpehaswl
ynhhpapgsreakllevttkprewvk

SCOPe Domain Coordinates for d1tlbu_:

Click to download the PDB-style file with coordinates for d1tlbu_.
(The format of our PDB-style files is described here.)

Timeline for d1tlbu_: