Lineage for d1tkub_ (1tku B:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 732157Fold d.115: YrdC/RibB [55820] (1 superfamily)
    core: alpha-beta(2)-alpha-beta-alpha(2)-beta(2)-alpha-beta-alpha-beta; 3 layers; mixed twisted sheet of 7 strands; order 7126354; strands 7 and 1 are parallel to each other
  4. 732158Superfamily d.115.1: YrdC/RibB [55821] (2 families) (S)
  5. 732171Family d.115.1.2: 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64372] (1 protein)
    contains one additional helix in the C-terminal extension
  6. 732172Protein 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64373] (4 species)
  7. 732181Species Candida albicans [TaxId:5476] [111135] (2 PDB entries)
  8. 732185Domain d1tkub_: 1tku B: [107117]
    complexed with 5rp

Details for d1tkub_

PDB Entry: 1tku (more details), 1.66 Å

PDB Description: Crystal Structure of 3,4-Dihydroxy-2-butanone 4-phosphate Synthase of Candida albicans in complex with Ribulose-5-phosphate
PDB Compounds: (B:) 3,4-dihydroxy-2-butanone 4-phosphate synthase

SCOP Domain Sequences for d1tkub_:

Sequence, based on SEQRES records: (download)

>d1tkub_ d.115.1.2 (B:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Candida albicans [TaxId: 5476]}
niftpieealeaykngeflivmddedrenegdlimaaelitqekmaflvryssgyvcvpl
seeranqlelppmlanrsdrhgtaytitcdfaegtttgisahdralttrslanpnskpqd
fikpghilplravpgllkkrrghteaavqlstlaglqpagvicelvrdedglmmrlddci
qfgkkhgikiininqlveyisk

Sequence, based on observed residues (ATOM records): (download)

>d1tkub_ d.115.1.2 (B:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Candida albicans [TaxId: 5476]}
niftpieealeaykngeflivmddedrenegdlimaaelitqekmaflvryssgyvcvpl
seeranqlelppmlagtaytitcdfaegtttgisahdralttrslanpnskpqdfikpgh
ilplravpgllkkrrghteaavqlstlaglqpagvicelvrdedglmmrlddciqfgkkh
gikiininqlveyisk

SCOP Domain Coordinates for d1tkub_:

Click to download the PDB-style file with coordinates for d1tkub_.
(The format of our PDB-style files is described here.)

Timeline for d1tkub_: