Lineage for d1tkua_ (1tku A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 609880Fold d.115: YrdC/RibB [55820] (1 superfamily)
    core: alpha-beta(2)-alpha-beta-alpha(2)-beta(2)-alpha-beta-alpha-beta; 3 layers; mixed twisted sheet of 7 strands; order 7126354; strands 7 and 1 are parallel to each other
  4. 609881Superfamily d.115.1: YrdC/RibB [55821] (2 families) (S)
  5. 609894Family d.115.1.2: 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64372] (1 protein)
    contains one additional helix in the C-terminal extension
  6. 609895Protein 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64373] (4 species)
  7. 609904Species Candida albicans [TaxId:5476] [111135] (2 PDB entries)
  8. 609907Domain d1tkua_: 1tku A: [107116]

Details for d1tkua_

PDB Entry: 1tku (more details), 1.66 Å

PDB Description: Crystal Structure of 3,4-Dihydroxy-2-butanone 4-phosphate Synthase of Candida albicans in complex with Ribulose-5-phosphate

SCOP Domain Sequences for d1tkua_:

Sequence, based on SEQRES records: (download)

>d1tkua_ d.115.1.2 (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Candida albicans}
niftpieealeaykngeflivmddedrenegdlimaaelitqekmaflvryssgyvcvpl
seeranqlelppmlanrsdrhgtaytitcdfaegtttgisahdralttrslanpnskpqd
fikpghilplravpgllkkrrghteaavqlstlaglqpagvicelvrdedglmmrlddci
qfgkkhgikiininqlveyisk

Sequence, based on observed residues (ATOM records): (download)

>d1tkua_ d.115.1.2 (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Candida albicans}
niftpieealeaykngeflivmddedrenegdlimaaelitqekmaflvryssgyvcvpl
seeranqlelppmlagtaytitcdfaegtttgisahdralttrslanpnskpqdfikpgh
ilplravpgllkkrrghteaavqlstlaglqpagvicelvrdedglmmrlddciqfgkkh
gikiininqlveyisk

SCOP Domain Coordinates for d1tkua_:

Click to download the PDB-style file with coordinates for d1tkua_.
(The format of our PDB-style files is described here.)

Timeline for d1tkua_: