Lineage for d1tksb_ (1tks B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2211949Fold d.115: YrdC/RibB [55820] (1 superfamily)
    core: alpha-beta(2)-alpha-beta-alpha(2)-beta(2)-alpha-beta-alpha-beta; 3 layers; mixed twisted sheet of 7 strands; order 7126354; strands 7 and 1 are parallel to each other
  4. 2211950Superfamily d.115.1: YrdC/RibB [55821] (3 families) (S)
  5. 2211965Family d.115.1.2: 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64372] (2 proteins)
    contains one additional helix in the C-terminal extension
    automatically mapped to Pfam PF00926
  6. 2211966Protein 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64373] (4 species)
  7. 2211987Species Yeast (Candida albicans) [TaxId:5476] [111135] (2 PDB entries)
    Uniprot Q5A3V6
  8. 2211989Domain d1tksb_: 1tks B: [107115]

Details for d1tksb_

PDB Entry: 1tks (more details), 1.6 Å

PDB Description: Crystal structure of 3,4-Dihydroxy-2-butanone 4-phosphate Synthase of Candida albicans
PDB Compounds: (B:) 3,4-dihydroxy-2-butanone 4-phosphate synthase

SCOPe Domain Sequences for d1tksb_:

Sequence, based on SEQRES records: (download)

>d1tksb_ d.115.1.2 (B:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Yeast (Candida albicans) [TaxId: 5476]}
niftpieealeaykngeflivmddedrenegdlimaaelitqekmaflvryssgyvcvpl
seeranqlelppmlanrsdrhgtaytitcdfaegtttgisahdralttrslanpnskpqd
fikpghilplravpgllkkrrghteaavqlstlaglqpagvicelvrdedglmmrlddci
qfgkkhgikiininqlveyisk

Sequence, based on observed residues (ATOM records): (download)

>d1tksb_ d.115.1.2 (B:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Yeast (Candida albicans) [TaxId: 5476]}
niftpieealeaykngeflivmddedrenegdlimaaelitqekmaflvryssgyvcvpl
seeranqlelppmlagtaytitcdfaegtttgisahdralttrslanpnskpqdfikpgh
ilplravpgllkkrrghteaavqlstlaglqpagvicelvrdedglmmrlddciqfgkkh
gikiininqlveyisk

SCOPe Domain Coordinates for d1tksb_:

Click to download the PDB-style file with coordinates for d1tksb_.
(The format of our PDB-style files is described here.)

Timeline for d1tksb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1tksa_