SCOP 1.73: Domain d1tksb_: 1tks B:

Lineage for d1tksb_ (1tks B:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.115: YrdC/RibB [55820] (1 superfamily)
   core: alpha-beta(2)-alpha-beta-alpha(2)-beta(2)-alpha-beta-alpha-beta; 3 layers; mixed twisted sheet of 7 strands; order 7126354; strands 7 and 1 are parallel to each other

4. Superfamily d.115.1: YrdC/RibB [55821] (2 families)

5. Family d.115.1.2: 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64372] (1 protein)
   contains one additional helix in the C-terminal extension

6. Protein 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64373] (4 species)

7. Species Candida albicans [TaxId:5476] [111135] (2 PDB entries)

8. Domain d1tksb_: 1tks B: [107115]

Details for d1tksb_

PDB Entry: 1tks, 1.6 Å

PDB Description: Crystal structure of 3,4-Dihydroxy-2-butanone 4-phosphate Synthase of Candida albicans

PDB Compounds: (B:) 3,4-dihydroxy-2-butanone 4-phosphate synthase

SCOP Domain Sequences for d1tksb_:

Sequence, based on SEQRES records:

>d1tksb_ d.115.1.2 (B:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Candida albicans [TaxId: 5476]}
niftpieealeaykngeflivmddedrenegdlimaaelitqekmaflvryssgyvcvpl
seeranqlelppmlanrsdrhgtaytitcdfaegtttgisahdralttrslanpnskpqd
fikpghilplravpgllkkrrghteaavqlstlaglqpagvicelvrdedglmmrlddci
qfgkkhgikiininqlveyisk

Sequence, based on observed residues (ATOM records):

>d1tksb_ d.115.1.2 (B:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Candida albicans [TaxId: 5476]}
niftpieealeaykngeflivmddedrenegdlimaaelitqekmaflvryssgyvcvpl
seeranqlelppmlagtaytitcdfaegtttgisahdralttrslanpnskpqdfikpgh
ilplravpgllkkrrghteaavqlstlaglqpagvicelvrdedglmmrlddciqfgkkh
gikiininqlveyisk

Timeline for d1tksb_:

• d1tksb_ first appeared in SCOP 1.69
  
• d1tksb_ appears in SCOP 1.71
  
• d1tksb_ appears in SCOP 1.75
  
• d1tksb_ appears in the current release, SCOPe 2.08