![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.115: YrdC/RibB [55820] (1 superfamily) core: alpha-beta(2)-alpha-beta-alpha(2)-beta(2)-alpha-beta-alpha-beta; 3 layers; mixed twisted sheet of 7 strands; order 7126354; strands 7 and 1 are parallel to each other |
![]() | Superfamily d.115.1: YrdC/RibB [55821] (3 families) ![]() |
![]() | Family d.115.1.2: 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64372] (2 proteins) contains one additional helix in the C-terminal extension automatically mapped to Pfam PF00926 |
![]() | Protein 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64373] (4 species) |
![]() | Species Yeast (Candida albicans) [TaxId:5476] [111135] (2 PDB entries) Uniprot Q5A3V6 |
![]() | Domain d1tksa_: 1tks A: [107114] |
PDB Entry: 1tks (more details), 1.6 Å
SCOPe Domain Sequences for d1tksa_:
Sequence, based on SEQRES records: (download)
>d1tksa_ d.115.1.2 (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Yeast (Candida albicans) [TaxId: 5476]} niftpieealeaykngeflivmddedrenegdlimaaelitqekmaflvryssgyvcvpl seeranqlelppmlanrsdrhgtaytitcdfaegtttgisahdralttrslanpnskpqd fikpghilplravpgllkkrrghteaavqlstlaglqpagvicelvrdedglmmrlddci qfgkkhgikiininqlveyisk
>d1tksa_ d.115.1.2 (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Yeast (Candida albicans) [TaxId: 5476]} niftpieealeaykngeflivmddedrenegdlimaaelitqekmaflvryssgyvcvpl seeranqlelppmlagtaytitcdfaegtttgisahdralttrslanpnskpqdfikpgh ilplravpgllkkrrghteaavqlstlaglqpagvicelvrdedglmmrlddciqfgkkh gikiininqlveyisk
Timeline for d1tksa_: