Lineage for d1tkna_ (1tkn A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 642337Fold a.47: STAT-like [47654] (6 superfamilies)
    4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix
  4. 642380Superfamily a.47.4: CAPPD, an extracellular domain of amyloid beta A4 protein [109843] (1 family) (S)
    the first three helices are longer than the fourth one and, taken separately, adopt a Spectrin repeat-like fold (scop_cf 46965)
  5. 642381Family a.47.4.1: CAPPD, an extracellular domain of amyloid beta A4 protein [109844] (1 protein)
  6. 642382Protein CAPPD, an extracellular domain of amyloid beta A4 protein [109845] (1 species)
  7. 642383Species Human (Homo sapiens) [TaxId:9606] [109846] (2 PDB entries)
  8. 642385Domain d1tkna_: 1tkn A: [107107]

Details for d1tkna_

PDB Entry: 1tkn (more details)

PDB Description: Solution structure of CAPPD*, an independently folded extracellular domain of human Amyloid-beta Precursor Protein
PDB Compounds: (A:) amyloid beta a4 protein

SCOP Domain Sequences for d1tkna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tkna_ a.47.4.1 (A:) CAPPD, an extracellular domain of amyloid beta A4 protein {Human (Homo sapiens) [TaxId: 9606]}
rveamlndrrrlalenyitalqavpprprhvfnmlkkyvraeqkdrqhtlkhfehvrmvd
pkkaaqirsqvmthlrviyermnqslsllynvpavaeeiqdevdellqke

SCOP Domain Coordinates for d1tkna_:

Click to download the PDB-style file with coordinates for d1tkna_.
(The format of our PDB-style files is described here.)

Timeline for d1tkna_: