SCOPe 2.08: Domain d1tkda2: 1tkd A:211-704

Lineage for d1tkda2 (1tkd A:211-704)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein T7 phage DNA polymerase [56678] (1 species)

7. Species Bacteriophage T7 [TaxId:10760] [56679] (17 PDB entries)
   Uniprot P00581

8. Domain d1tkda2: 1tkd A:211-704 [107087]
   Other proteins in same PDB: d1tkda1, d1tkdb_
   protein/DNA complex; complexed with 1pe, d3t, mes, mg, so4

Details for d1tkda2

PDB Entry: 1tkd, 2.49 Å

PDB Description: T7 DNA polymerase ternary complex with 8 oxo guanosine and dCMP at the elongation site

PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d1tkda2:

Sequence; same for both SEQRES and ATOM records:

>d1tkda2 e.8.1.1 (A:211-704) T7 phage DNA polymerase {Bacteriophage T7 [TaxId: 10760]}
leavdiehraawllakqerngfpfdtkaieelyvelaarrsellrkltetfgswyqpkgg
temfchprtgkplpkypriktpkvggifkkpknkaqregrepceldtreyvagapytpve
hvvfnpssrdhiqkklqeagwvptkytdkgapvvddevlegvrvddpekqaaidlikeyl
miqkrigqsaegdkawlryvaedgkihgsvnpngavtgrathafpnlaqipgvrspygeq
craafgaehhldgitgkpwvqagidasglelrclahfmarfdngeyaheilngdihtknq
iaaelptrdnaktfiygflygagdekigqivgagkergkelkkkflentpaiaalresiq
qtlvessqwvageqqvkwkrrwikgldgrkvhvrsphaalntllqsagalicklwiikte
emlvekglkhgwdgdfaymawvhdeiqvgcrteeiaqvvietaqeamrwvgdhwnfrcll
dtegkmgpnwaich

Timeline for d1tkda2:

• d1tkda2 first appeared in SCOP 1.69
  
• d1tkda2 appears in SCOPe 2.07