Lineage for d1tk9c_ (1tk9 C:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 493569Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 493570Superfamily c.80.1: SIS domain [53697] (3 families) (S)
  5. 493630Family c.80.1.3: mono-SIS domain [69599] (5 proteins)
    dimer of mono-domain subunits
  6. 493646Protein Phosphoheptose isomerase GmhA1 [110723] (2 species)
  7. 493647Species Campylobacter jejuni [TaxId:197] [110724] (1 PDB entry)
  8. 493650Domain d1tk9c_: 1tk9 C: [107084]

Details for d1tk9c_

PDB Entry: 1tk9 (more details), 2.1 Å

PDB Description: crystal structure of phosphoheptose isomerase 1

SCOP Domain Sequences for d1tk9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tk9c_ c.80.1.3 (C:) Phosphoheptose isomerase GmhA1 {Campylobacter jejuni}
mslinlvekewqehqkivqaseilkgqiakvgellceclkkggkilicgnggsaadaqhf
aaelsgrykkerkalagialttdtsalsaigndygfefvfsrqvealgnekdvligists
gkspnvlealkkakelnmlclglsgkgggmmnklcdhnlvvpsddtariqemhiliihtl
cqiidesf

SCOP Domain Coordinates for d1tk9c_:

Click to download the PDB-style file with coordinates for d1tk9c_.
(The format of our PDB-style files is described here.)

Timeline for d1tk9c_: