Lineage for d1tk9b1 (1tk9 B:4-188)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908082Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2908083Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2908254Family c.80.1.3: mono-SIS domain [69599] (6 proteins)
    dimer of mono-domain subunits
  6. 2908270Protein Phosphoheptose isomerase GmhA1 [110723] (4 species)
  7. 2908271Species Campylobacter jejuni [TaxId:197] [110724] (1 PDB entry)
    Uniprot Q9PNE6
  8. 2908273Domain d1tk9b1: 1tk9 B:4-188 [107083]
    Other proteins in same PDB: d1tk9a2, d1tk9b2, d1tk9c2, d1tk9d2
    Structural genomics target

Details for d1tk9b1

PDB Entry: 1tk9 (more details), 2.1 Å

PDB Description: crystal structure of phosphoheptose isomerase 1
PDB Compounds: (B:) Phosphoheptose isomerase 1

SCOPe Domain Sequences for d1tk9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tk9b1 c.80.1.3 (B:4-188) Phosphoheptose isomerase GmhA1 {Campylobacter jejuni [TaxId: 197]}
inlvekewqehqkivqaseilkgqiakvgellceclkkggkilicgnggsaadaqhfaae
lsgrykkerkalagialttdtsalsaigndygfefvfsrqvealgnekdvligistsgks
pnvlealkkakelnmlclglsgkgggmmnklcdhnlvvpsddtariqemhiliihtlcqi
idesf

SCOPe Domain Coordinates for d1tk9b1:

Click to download the PDB-style file with coordinates for d1tk9b1.
(The format of our PDB-style files is described here.)

Timeline for d1tk9b1: