Lineage for d1tk8b_ (1tk8 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2484065Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2484131Protein Thioredoxin [52835] (16 species)
  7. 2484153Species Escherichia coli [TaxId:562] [52836] (55 PDB entries)
    Uniprot P00274 ! Uniprot P00581
  8. 2484173Domain d1tk8b_: 1tk8 B: [107081]
    Other proteins in same PDB: d1tk8a1, d1tk8a2
    protein/DNA complex; complexed with 1pe, d3t, mes, mg, so4

Details for d1tk8b_

PDB Entry: 1tk8 (more details), 2.5 Å

PDB Description: T7 DNA polymerase ternary complex with 8 oxo guanosine and dAMP at the elongation site
PDB Compounds: (B:) Thioredoxin 1

SCOPe Domain Sequences for d1tk8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tk8b_ c.47.1.1 (B:) Thioredoxin {Escherichia coli [TaxId: 562]}
kiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnidq
npgtapkygirgiptlllfkngevaatkvgalskgqlkefldanl

SCOPe Domain Coordinates for d1tk8b_:

Click to download the PDB-style file with coordinates for d1tk8b_.
(The format of our PDB-style files is described here.)

Timeline for d1tk8b_: