![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
![]() | Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) ![]() "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
![]() | Family e.8.1.1: DNA polymerase I [56673] (5 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
![]() | Protein T7 phage DNA polymerase [56678] (1 species) |
![]() | Species Bacteriophage T7 [TaxId:10760] [56679] (17 PDB entries) Uniprot P00581 |
![]() | Domain d1tk8a2: 1tk8 A:211-704 [107080] Other proteins in same PDB: d1tk8a1, d1tk8b_ protein/DNA complex; complexed with 1pe, d3t, mes, mg, so4 |
PDB Entry: 1tk8 (more details), 2.5 Å
SCOPe Domain Sequences for d1tk8a2:
Sequence, based on SEQRES records: (download)
>d1tk8a2 e.8.1.1 (A:211-704) T7 phage DNA polymerase {Bacteriophage T7 [TaxId: 10760]} leavdiehraawllakqerngfpfdtkaieelyvelaarrsellrkltetfgswyqpkgg temfchprtgkplpkypriktpkvggifkkpknkaqregrepceldtreyvagapytpve hvvfnpssrdhiqkklqeagwvptkytdkgapvvddevlegvrvddpekqaaidlikeyl miqkrigqsaegdkawlryvaedgkihgsvnpngavtgrathafpnlaqipgvrspygeq craafgaehhldgitgkpwvqagidasglelrclahfmarfdngeyaheilngdihtknq iaaelptrdnaktfiygflygagdekigqivgagkergkelkkkflentpaiaalresiq qtlvessqwvageqqvkwkrrwikgldgrkvhvrsphaalntllqsagalicklwiikte emlvekglkhgwdgdfaymawvhdeiqvgcrteeiaqvvietaqeamrwvgdhwnfrcll dtegkmgpnwaich
>d1tk8a2 e.8.1.1 (A:211-704) T7 phage DNA polymerase {Bacteriophage T7 [TaxId: 10760]} leavdiehraawllakqerngfpfdtkaieelyvelaarrsellrkltetfgswyqpkgg temfchprtgkplpkypriktpkvggifkkpknkaqregrepceldtreyvagapytpve hvvfnpssrdhiqkklqeagwvptkytdkgapvvddevlegvrvddpekqaaidlikeyl miqkrigqsaegdkawlryvaedgkihgsvnpngavtgrathafpnlaqipgvrspygeq craafgaehhldgitgkpwvqagidasglelrclahfmarfdngeyaheilngdihtknq iaaelptrdnaktfiygflygagdekigqivgagkergkelkkkflentpaiaalresiq qtlvessqqvkwkrrwikgldgrkvhvrsphaalntllqsagalicklwiikteemlvek glkhgwdgdfaymawvhdeiqvgcrteeiaqvvietaqeamrwvgdhwnfrclldtegkm gpnwaich
Timeline for d1tk8a2: