SCOP 1.73: Domain d1tk8a1: 1tk8 A:1-210

Lineage for d1tk8a1 (1tk8 A:1-210)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (12 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (14 proteins)
   contains Pfam PF00929

6. Protein Exonuclease domain of T7 DNA polymerase [53123] (1 species)

7. Species Bacteriophage T7 [TaxId:10760] [53124] (16 PDB entries)

8. Domain d1tk8a1: 1tk8 A:1-210 [107079]
   Other proteins in same PDB: d1tk8a2, d1tk8b_
   complexed with 1pe, 2da, 8og, d3t, mes, mg, so4

Details for d1tk8a1

PDB Entry: 1tk8, 2.5 Å

PDB Description: T7 DNA polymerase ternary complex with 8 oxo guanosine and dAMP at the elongation site

PDB Compounds: (A:) DNA polymerase

SCOP Domain Sequences for d1tk8a1:

Sequence; same for both SEQRES and ATOM records:

>d1tk8a1 c.55.3.5 (A:1-210) Exonuclease domain of T7 DNA polymerase {Bacteriophage T7 [TaxId: 10760]}
mivsdieanallesvtkfhcgviydystaeyvsyrpsdfgayldaleaevargglivfhn
ghkydvpaltklaklqlnrefhlprencidtlvlsrlihsnlkdtdmgllrsgklpgale
awgyrlgemkgeykddfkrmleeqgeeyvdgmewwnfneemmdynvqdvvvtkallekll
sdkhyfppeidftdvgyttfwses

Timeline for d1tk8a1:

• d1tk8a1 first appeared in SCOP 1.69
  
• d1tk8a1 appears in SCOP 1.71
  
• d1tk8a1 appears in SCOP 1.75
  
• d1tk8a1 appears in the current release, SCOPe 2.08