![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins) contains Pfam PF00929 |
![]() | Protein Exonuclease domain of T7 DNA polymerase [53123] (1 species) |
![]() | Species Bacteriophage T7 [TaxId:10760] [53124] (17 PDB entries) Uniprot P00581 |
![]() | Domain d1tk8a1: 1tk8 A:1-210 [107079] Other proteins in same PDB: d1tk8a2, d1tk8b_ protein/DNA complex; complexed with 1pe, d3t, mes, mg, so4 |
PDB Entry: 1tk8 (more details), 2.5 Å
SCOPe Domain Sequences for d1tk8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tk8a1 c.55.3.5 (A:1-210) Exonuclease domain of T7 DNA polymerase {Bacteriophage T7 [TaxId: 10760]} mivsdieanallesvtkfhcgviydystaeyvsyrpsdfgayldaleaevargglivfhn ghkydvpaltklaklqlnrefhlprencidtlvlsrlihsnlkdtdmgllrsgklpgale awgyrlgemkgeykddfkrmleeqgeeyvdgmewwnfneemmdynvqdvvvtkallekll sdkhyfppeidftdvgyttfwses
Timeline for d1tk8a1: