SCOPe 2.08: Domain d1tk5a1: 1tk5 A:1-210

Lineage for d1tk5a1 (1tk5 A:1-210)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
   contains Pfam PF00929

6. Protein Exonuclease domain of T7 DNA polymerase [53123] (1 species)

7. Species Bacteriophage T7 [TaxId:10760] [53124] (17 PDB entries)
   Uniprot P00581

8. Domain d1tk5a1: 1tk5 A:1-210 [107074]
   Other proteins in same PDB: d1tk5a2, d1tk5b_
   protein/DNA complex; complexed with 1pe, mes, mg, so4

Details for d1tk5a1

PDB Entry: 1tk5, 2.2 Å

PDB Description: t7 dna polymerase binary complex with 8 oxo guanosine in the templating strand

PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d1tk5a1:

Sequence; same for both SEQRES and ATOM records:

>d1tk5a1 c.55.3.5 (A:1-210) Exonuclease domain of T7 DNA polymerase {Bacteriophage T7 [TaxId: 10760]}
mivsdieanallesvtkfhcgviydystaeyvsyrpsdfgayldaleaevargglivfhn
ghkydvpaltklaklqlnrefhlprencidtlvlsrlihsnlkdtdmgllrsgklpgale
awgyrlgemkgeykddfkrmleeqgeeyvdgmewwnfneemmdynvqdvvvtkallekll
sdkhyfppeidftdvgyttfwses

Timeline for d1tk5a1:

• d1tk5a1 first appeared in SCOP 1.69
  
• d1tk5a1 appears in SCOPe 2.07