Lineage for d1tk4a_ (1tk4 A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 449032Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 449033Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 449038Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 449118Protein Snake phospholipase A2 [48624] (35 species)
  7. 449265Species Snake (Daboia russelli pulchella) [48630] (26 PDB entries)
  8. 449266Domain d1tk4a_: 1tk4 A: [107073]

Details for d1tk4a_

PDB Entry: 1tk4 (more details), 1.1 Å

PDB Description: Crystal structure of russells viper phospholipase A2 in complex with a specifically designed tetrapeptide Ala-Ile-Arg-Ser at 1.1 A resolution

SCOP Domain Sequences for d1tk4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tk4a_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Daboia russelli pulchella)}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

SCOP Domain Coordinates for d1tk4a_:

Click to download the PDB-style file with coordinates for d1tk4a_.
(The format of our PDB-style files is described here.)

Timeline for d1tk4a_: