SCOPe 2.04: Domain d1tk3b2: 1tk3 B:509-764

Lineage for d1tk3b2 (1tk3 B:509-764)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins)
   N-terminal domain is a 8-bladed beta-propeller
   automatically mapped to Pfam PF00326

6. Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82499] (54 PDB entries)
   Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487

8. Domain d1tk3b2: 1tk3 B:509-764 [107072]
   Other proteins in same PDB: d1tk3a1, d1tk3b1
   complexed with nag

Details for d1tk3b2

PDB Entry: 1tk3, 2 Å

PDB Description: crystal structure of human apo dipeptidyl peptidase iv/cd26

PDB Compounds: (B:) dipeptidyl peptidase IV

SCOPe Domain Sequences for d1tk3b2:

Sequence; same for both SEQRES and ATOM records:

>d1tk3b2 c.69.1.24 (B:509-764) Dipeptidyl peptidase IV/CD26, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfs

Timeline for d1tk3b2:

• d1tk3b2 first appeared in SCOP 1.69
  
• d1tk3b2 appears in SCOPe 2.03
  
• d1tk3b2 appears in SCOPe 2.05
  
• d1tk3b2 appears in the current release, SCOPe 2.08