Lineage for d1tk3a2 (1tk3 A:509-764)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 841866Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 841867Superfamily c.69.1: alpha/beta-Hydrolases [53474] (41 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 842718Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins)
    N-terminal domain is a 8-bladed beta-propeller
  6. 842725Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)
  7. 842726Species Human (Homo sapiens) [TaxId:9606] [82499] (29 PDB entries)
    Uniprot P27487 39-776
    Uniprot P27487
    Uniprot P27487
    Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487
  8. 842737Domain d1tk3a2: 1tk3 A:509-764 [107070]
    Other proteins in same PDB: d1tk3a1, d1tk3b1

Details for d1tk3a2

PDB Entry: 1tk3 (more details), 2 Å

PDB Description: crystal structure of human apo dipeptidyl peptidase iv/cd26
PDB Compounds: (A:) dipeptidyl peptidase IV

SCOP Domain Sequences for d1tk3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tk3a2 c.69.1.24 (A:509-764) Dipeptidyl peptidase IV/CD26, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfs

SCOP Domain Coordinates for d1tk3a2:

Click to download the PDB-style file with coordinates for d1tk3a2.
(The format of our PDB-style files is described here.)

Timeline for d1tk3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tk3a1