Lineage for d1tk0a2 (1tk0 A:211-704)

  1. Root: SCOP 1.69
  2. 517079Class e: Multi-domain proteins (alpha and beta) [56572] (46 folds)
  3. 517941Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 517942Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 517943Family e.8.1.1: DNA polymerase I [56673] (3 proteins)
  6. 518035Protein T7 phage DNA polymerase [56678] (1 species)
  7. 518036Species Bacteriophage T7 [TaxId:10760] [56679] (11 PDB entries)
  8. 518039Domain d1tk0a2: 1tk0 A:211-704 [107064]
    Other proteins in same PDB: d1tk0a1, d1tk0b_

Details for d1tk0a2

PDB Entry: 1tk0 (more details), 2.3 Å

PDB Description: t7 dna polymerase ternary complex with 8 oxo guanosine and ddctp at the insertion site

SCOP Domain Sequences for d1tk0a2:

Sequence, based on SEQRES records: (download)

>d1tk0a2 e.8.1.1 (A:211-704) T7 phage DNA polymerase {Bacteriophage T7}
leavdiehraawllakqerngfpfdtkaieelyvelaarrsellrkltetfgswyqpkgg
temfchprtgkplpkypriktpkvggifkkpknkaqregrepceldtreyvagapytpve
hvvfnpssrdhiqkklqeagwvptkytdkgapvvddevlegvrvddpekqaaidlikeyl
miqkrigqsaegdkawlryvaedgkihgsvnpngavtgrathafpnlaqipgvrspygeq
craafgaehhldgitgkpwvqagidasglelrclahfmarfdngeyaheilngdihtknq
iaaelptrdnaktfiygflygagdekigqivgagkergkelkkkflentpaiaalresiq
qtlvessqwvageqqvkwkrrwikgldgrkvhvrsphaalntllqsagalicklwiikte
emlvekglkhgwdgdfaymawvhdeiqvgcrteeiaqvvietaqeamrwvgdhwnfrcll
dtegkmgpnwaich

Sequence, based on observed residues (ATOM records): (download)

>d1tk0a2 e.8.1.1 (A:211-704) T7 phage DNA polymerase {Bacteriophage T7}
leavdiehraawllakqerngfpfdtkaieelyvelaarrsellrkltetfgswyqpkgg
temfchprtgkplpkypriktpkvggifkkpegrepceldtreyvagapytpvehvvfnp
ssrdhiqkklqeagwvptkytdkgapvvddevlegvrvddpekqaaidlikeylmiqkri
gqsaegdkawlryvaedgkihgsvnpngavtgrathafpnlaqipgvrspygeqcraafg
aehhldgitgkpwvqagidasglelrclahfmarfdngeyaheilngdihtknqiaaelp
trdnaktfiygflygagdekigqivgagkergkelkkkflentpaiaalresiqqtlves
sqqvkwkrrwikgldgrkvhvrsphaalntllqsagalicklwiikteemlvekglkhgw
dgdfaymawvhdeiqvgcrteeiaqvvietaqeamrwvgdhwnfrclldtegkmgpnwai
ch

SCOP Domain Coordinates for d1tk0a2:

Click to download the PDB-style file with coordinates for d1tk0a2.
(The format of our PDB-style files is described here.)

Timeline for d1tk0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tk0a1
View in 3D
Domains from other chains:
(mouse over for more information)
d1tk0b_