Lineage for d1tk0a1 (1tk0 A:1-210)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1373755Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1374321Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (16 proteins)
    contains Pfam PF00929
  6. 1374533Protein Exonuclease domain of T7 DNA polymerase [53123] (1 species)
  7. 1374534Species Bacteriophage T7 [TaxId:10760] [53124] (17 PDB entries)
    Uniprot P00581
  8. 1374540Domain d1tk0a1: 1tk0 A:1-210 [107063]
    Other proteins in same PDB: d1tk0a2, d1tk0b_
    protein/DNA complex; complexed with 1pe, dct, mes, mg, so4

Details for d1tk0a1

PDB Entry: 1tk0 (more details), 2.3 Å

PDB Description: t7 dna polymerase ternary complex with 8 oxo guanosine and ddctp at the insertion site
PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d1tk0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tk0a1 c.55.3.5 (A:1-210) Exonuclease domain of T7 DNA polymerase {Bacteriophage T7 [TaxId: 10760]}
mivsdieanallesvtkfhcgviydystaeyvsyrpsdfgayldaleaevargglivfhn
ghkydvpaltklaklqlnrefhlprencidtlvlsrlihsnlkdtdmgllrsgklpgale
awgyrlgemkgeykddfkrmleeqgeeyvdgmewwnfneemmdynvqdvvvtkallekll
sdkhyfppeidftdvgyttfwses

SCOPe Domain Coordinates for d1tk0a1:

Click to download the PDB-style file with coordinates for d1tk0a1.
(The format of our PDB-style files is described here.)

Timeline for d1tk0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tk0a2
View in 3D
Domains from other chains:
(mouse over for more information)
d1tk0b_