Lineage for d1tjya1 (1tjy A:27-340)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2161445Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2161446Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2161447Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
  6. 2161448Protein AI-2 receptor LsrB [110745] (1 species)
  7. 2161449Species Salmonella typhi [TaxId:90370] [110746] (2 PDB entries)
    Uniprot Q8Z2X8 27-340
  8. 2161450Domain d1tjya1: 1tjy A:27-340 [107062]
    Other proteins in same PDB: d1tjya2
    complexed with pav

Details for d1tjya1

PDB Entry: 1tjy (more details), 1.3 Å

PDB Description: crystal structure of salmonella typhimurium ai-2 receptor lsrb in complex with r-thmf
PDB Compounds: (A:) sugar transport protein

SCOPe Domain Sequences for d1tjya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tjya1 c.93.1.1 (A:27-340) AI-2 receptor LsrB {Salmonella typhi [TaxId: 90370]}
aeriafipklvgvgfftsggngaqeagkalgidvtydgptepsvsgqvqlvnnfvnqgyd
aiivsavspdglcpalkramqrgvkiltwdsdtkpecrsyyinqgtpkqlgsmlvemaah
qvdkekakvaffyssptvtdqnqwvkeakakisqehpgweivttqfgyndatkslqtaeg
iikaypdldaiiapdanalpaaaqaaenlkrnnlaivgfstpnvmrpyvqrgtvkefglw
dvvqqgkisvyvanallknmpmnvgdsldipgigkvtvspnseqgyhyeakgngivllpe
rvifnkdnidkydf

SCOPe Domain Coordinates for d1tjya1:

Click to download the PDB-style file with coordinates for d1tjya1.
(The format of our PDB-style files is described here.)

Timeline for d1tjya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tjya2