Lineage for d1tjvc_ (1tjv C:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 777280Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 777281Superfamily a.127.1: L-aspartase-like [48557] (2 families) (S)
  5. 777282Family a.127.1.1: L-aspartase/fumarase [48558] (5 proteins)
  6. 777304Protein Argininosuccinate lyase/delta-crystallin [48564] (4 species)
  7. 777305Species Domestic duck (Anas platyrhynchos), delta-crystallin [TaxId:8839] [48566] (10 PDB entries)
    Uniprot P24058 P24057
  8. 777308Domain d1tjvc_: 1tjv C: [107056]

Details for d1tjvc_

PDB Entry: 1tjv (more details), 2 Å

PDB Description: crystal structure of t161d duck delta 2 crystallin mutant
PDB Compounds: (C:) delta crystallin II

SCOP Domain Sequences for d1tjvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tjvc_ a.127.1.1 (C:) Argininosuccinate lyase/delta-crystallin {Domestic duck (Anas platyrhynchos), delta-crystallin [TaxId: 8839]}
tdpimeklnssiaydqrlsevdiqgsmayakalekagiltktelekilsglekiseewsk
gvfvvkqsdedihtanerrlkeligdiagklhtgrsrndqvvtdlklfmknslsiisthl
lqliktlveraaieidvilpgydhlqkaqpirwsqfllshavaltrdserlgevkkrinv
lplgsgalagnpldidremlrselefasislnsmdaiserdfvveflsfatllmihlskm
aedliiystsefgfltlsdafstgsslmpqkknpdslelirskagrvfgrlasilmvlkg
lpstynkdlqedkeavfdvvdtltavlqvatgvistlqiskenmekaltpemlatdlaly
lvrkgvpfrqahtasgkavhlaetkgitinklsledlksispqfssdvsqvfnfvnsveq
ytalagtakssvttqieqlrelmkkqkeqa

SCOP Domain Coordinates for d1tjvc_:

Click to download the PDB-style file with coordinates for d1tjvc_.
(The format of our PDB-style files is described here.)

Timeline for d1tjvc_: