Lineage for d1tjva_ (1tjv A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 924427Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 924428Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 924429Family a.127.1.1: L-aspartase/fumarase [48558] (6 proteins)
  6. 924451Protein Argininosuccinate lyase/delta-crystallin [48564] (4 species)
  7. 924452Species Domestic duck (Anas platyrhynchos), delta-crystallin [TaxId:8839] [48566] (10 PDB entries)
    Uniprot P24058 P24057
  8. 924453Domain d1tjva_: 1tjv A: [107054]
    mutant

Details for d1tjva_

PDB Entry: 1tjv (more details), 2 Å

PDB Description: crystal structure of t161d duck delta 2 crystallin mutant
PDB Compounds: (A:) delta crystallin II

SCOPe Domain Sequences for d1tjva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tjva_ a.127.1.1 (A:) Argininosuccinate lyase/delta-crystallin {Domestic duck (Anas platyrhynchos), delta-crystallin [TaxId: 8839]}
tdpimeklnssiaydqrlsevdiqgsmayakalekagiltktelekilsglekiseewsk
gvfvvkqsdedihtanerrlkeligdiagklhtgrsrndqvvtdlklfmknslsiisthl
lqliktlveraaieidvilpgydhlqkaqpirwsqfllshavaltrdserlgevkkrinv
lplgsgalagnpldidremlrselefasislnsmdaiserdfvveflsfatllmihlskm
aedliiystsefgfltlsdafstgsslmpqkknpdslelirskagrvfgrlasilmvlkg
lpstynkdlqedkeavfdvvdtltavlqvatgvistlqiskenmekaltpemlatdlaly
lvrkgvpfrqahtasgkavhlaetkgitinklsledlksispqfssdvsqvfnfvnsveq
ytalagtakssvttqieqlrelmkkqkeq

SCOPe Domain Coordinates for d1tjva_:

Click to download the PDB-style file with coordinates for d1tjva_.
(The format of our PDB-style files is described here.)

Timeline for d1tjva_: