Lineage for d1tjud_ (1tju D:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1748834Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 1748835Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 1748836Family a.127.1.1: L-aspartase/fumarase [48558] (6 proteins)
  6. 1748858Protein Argininosuccinate lyase/delta-crystallin [48564] (4 species)
  7. 1748859Species Domestic duck (Anas platyrhynchos), delta-crystallin [TaxId:8839] [48566] (10 PDB entries)
    Uniprot P24058 P24057
  8. 1748875Domain d1tjud_: 1tju D: [107053]
    mutant

Details for d1tjud_

PDB Entry: 1tju (more details), 2.1 Å

PDB Description: Crystal Structure of T161S Duck Delta 2 Crystallin Mutant
PDB Compounds: (D:) delta crystallin II

SCOPe Domain Sequences for d1tjud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tjud_ a.127.1.1 (D:) Argininosuccinate lyase/delta-crystallin {Domestic duck (Anas platyrhynchos), delta-crystallin [TaxId: 8839]}
tdpimeklnssiaydqrlsevdiqgsmayakalekagiltktelekilsglekiseewsk
gvfvvkqsdedihtanerrlkeligdiagklhtgrsrndqvvtdlklfmknslsiisthl
lqliktlveraaieidvilpgyshlqkaqpirwsqfllshavaltrdserlgevkkrinv
lplgsgalagnpldidremlrselefasislnsmdaiserdfvveflsfatllmihlskm
aedliiystsefgfltlsdafstgsslmpqkknpdslelirskagrvfgrlasilmvlkg
lpstynkdlqedkeavfdvvdtltavlqvatgvistlqiskenmekaltpemlatdlaly
lvrkgvpfrqahtasgkavhlaetkgitinklsledlksispqfssdvsqvfnfvnsveq
ytalagtakssvttqieqlrelmkkqkeq

SCOPe Domain Coordinates for d1tjud_:

Click to download the PDB-style file with coordinates for d1tjud_.
(The format of our PDB-style files is described here.)

Timeline for d1tjud_: