Lineage for d1tjud_ (1tju D:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 448525Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 448526Superfamily a.127.1: L-aspartase-like [48557] (2 families) (S)
  5. 448527Family a.127.1.1: L-aspartase/fumarase [48558] (5 proteins)
  6. 448549Protein Argininosuccinate lyase/delta-crystallin [48564] (3 species)
  7. 448550Species Domestic duck (Anas platyrhynchos), delta-crystallin [TaxId:8839] [48566] (8 PDB entries)
  8. 448566Domain d1tjud_: 1tju D: [107053]

Details for d1tjud_

PDB Entry: 1tju (more details), 2.1 Å

PDB Description: Crystal Structure of T161S Duck Delta 2 Crystallin Mutant

SCOP Domain Sequences for d1tjud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tjud_ a.127.1.1 (D:) Argininosuccinate lyase/delta-crystallin {Domestic duck (Anas platyrhynchos), delta-crystallin}
tdpimeklnssiaydqrlsevdiqgsmayakalekagiltktelekilsglekiseewsk
gvfvvkqsdedihtanerrlkeligdiagklhtgrsrndqvvtdlklfmknslsiisthl
lqliktlveraaieidvilpgyshlqkaqpirwsqfllshavaltrdserlgevkkrinv
lplgsgalagnpldidremlrselefasislnsmdaiserdfvveflsfatllmihlskm
aedliiystsefgfltlsdafstgsslmpqkknpdslelirskagrvfgrlasilmvlkg
lpstynkdlqedkeavfdvvdtltavlqvatgvistlqiskenmekaltpemlatdlaly
lvrkgvpfrqahtasgkavhlaetkgitinklsledlksispqfssdvsqvfnfvnsveq
ytalagtakssvttqieqlrelmkkqkeq

SCOP Domain Coordinates for d1tjud_:

Click to download the PDB-style file with coordinates for d1tjud_.
(The format of our PDB-style files is described here.)

Timeline for d1tjud_: