Lineage for d1tjub_ (1tju B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010257Family a.127.1.1: L-aspartase/fumarase [48558] (6 protein domains)
  6. 2010279Protein Argininosuccinate lyase/delta-crystallin [48564] (4 species)
  7. 2010280Species Domestic duck (Anas platyrhynchos), delta-crystallin [TaxId:8839] [48566] (10 PDB entries)
    Uniprot P24058 P24057
  8. 2010294Domain d1tjub_: 1tju B: [107051]
    mutant

Details for d1tjub_

PDB Entry: 1tju (more details), 2.1 Å

PDB Description: Crystal Structure of T161S Duck Delta 2 Crystallin Mutant
PDB Compounds: (B:) delta crystallin II

SCOPe Domain Sequences for d1tjub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tjub_ a.127.1.1 (B:) Argininosuccinate lyase/delta-crystallin {Domestic duck (Anas platyrhynchos), delta-crystallin [TaxId: 8839]}
tdpimeklnssiaydqrlsevdiqgsmayakalekagiltktelekilsglekiseewsk
gvfvvkqsdedihtanerrlkeligdiagklhtgrsrndqvvtdlklfmknslsiisthl
lqliktlveraaieidvilpgyshlqkaqpirwsqfllshavaltrdserlgevkkrinv
lplgsgalagnpldidremlrselefasislnsmdaiserdfvveflsfatllmihlskm
aedliiystsefgfltlsdafstgsslmpqkknpdslelirskagrvfgrlasilmvlkg
lpstynkdlqedkeavfdvvdtltavlqvatgvistlqiskenmekaltpemlatdlaly
lvrkgvpfrqahtasgkavhlaetkgitinklsledlksispqfssdvsqvfnfvnsveq
ytalagtakssvttqieqlrelmkkqkeqa

SCOPe Domain Coordinates for d1tjub_:

Click to download the PDB-style file with coordinates for d1tjub_.
(The format of our PDB-style files is described here.)

Timeline for d1tjub_: