Lineage for d1tjna_ (1tjn A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912237Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2912238Superfamily c.92.1: Chelatase [53800] (4 families) (S)
    interdomain linker is short; swapping of C-terminal helices between the two domains
  5. 2912329Family c.92.1.3: CbiX-like [110742] (2 proteins)
    Pfam PF01903; single-domain protein; forms the C-terminal helix-swapped dimer similar to the CbiK subunit
  6. 2912330Protein Sirohydrochlorin cobaltochelatase CbiX [110743] (1 species)
  7. 2912331Species Archaeoglobus fulgidus [TaxId:2234] [110744] (1 PDB entry)
    Uniprot O29537
  8. 2912332Domain d1tjna_: 1tjn A: [107048]
    Structural genomics target; AF0721

Details for d1tjna_

PDB Entry: 1tjn (more details), 2.01 Å

PDB Description: Crystal structure of hypothetical protein af0721 from Archaeoglobus fulgidus
PDB Compounds: (A:) sirohydrochlorin cobaltochelatase

SCOPe Domain Sequences for d1tjna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tjna_ c.92.1.3 (A:) Sirohydrochlorin cobaltochelatase CbiX {Archaeoglobus fulgidus [TaxId: 2234]}
mrrglvivghgsqlnhyrevmelhrkrieesgafdevkiafaarkrrpmpdeairemncd
iiyvvplfisyglhvtedlpdllgfprgrgikegefegkkvvicepigedyfvtyailns
vfrig

SCOPe Domain Coordinates for d1tjna_:

Click to download the PDB-style file with coordinates for d1tjna_.
(The format of our PDB-style files is described here.)

Timeline for d1tjna_: