SCOP 1.75: Domain d1tjma_: 1tjm A:

Lineage for d1tjma_ (1tjm A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families)
   two constituent families are related by circular permutation

5. Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (10 proteins)
   topologically similar to the C-terminal domain of PapD

6. Protein Synaptogamin I [49576] (2 species)
   duplication: contains tandem repeat of two similar domains

7. Species Rat (Rattus norvegicus) [TaxId:10116] [49577] (7 PDB entries)
   Uniprot P21707 271-419
   Uniprot P21707 271-419
   Uniprot P21707 271-419 ! Uniprot P21707 271-419

8. Domain d1tjma_: 1tjm A: [107047]
   complexed with gol, sr

Details for d1tjma_

PDB Entry: 1tjm, 1.18 Å

PDB Description: Crystallographic Identification of Sr2+ Coordination Site in Synaptotagmin I C2B Domain

PDB Compounds: (A:) Synaptotagmin I

SCOP Domain Sequences for d1tjma_:

Sequence; same for both SEQRES and ATOM records:

>d1tjma_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]}
sgggggileklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkr
lkkkkttikkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgyns
tgaelrhwsdmlanprrpiaqwhtlqveeevdamlav

Timeline for d1tjma_:

• d1tjma_ first appeared in SCOP 1.69
  
• d1tjma_ appears in SCOP 1.73
  
• d1tjma_ appears in SCOPe 2.01
  
• d1tjma_ appears in the current release, SCOPe 2.08, called d1tjma1