Lineage for d1tjli2 (1tjl I:111-151)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035586Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 3035587Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 3036075Family g.39.1.13: Prokaryotic DksA/TraR C4-type zinc finger [111448] (1 protein)
    Pfam PF01258; Pfam coverage extends to the second helix of the upstream alpha-hairpin domain
  6. 3036076Protein DnaK suppressor protein DksA, zinc finger domain [111449] (1 species)
  7. 3036077Species Escherichia coli [TaxId:562] [111450] (1 PDB entry)
    Uniprot P18274 7-151
  8. 3036086Domain d1tjli2: 1tjl I:111-151 [107044]
    Other proteins in same PDB: d1tjla1, d1tjlb1, d1tjlc1, d1tjld1, d1tjle1, d1tjlf1, d1tjlg1, d1tjlh1, d1tjli1, d1tjlj1
    complexed with zn

Details for d1tjli2

PDB Entry: 1tjl (more details), 2 Å

PDB Description: Crystal structure of transcription factor DksA from E. coli
PDB Compounds: (I:) DnaK suppressor protein

SCOPe Domain Sequences for d1tjli2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tjli2 g.39.1.13 (I:111-151) DnaK suppressor protein DksA, zinc finger domain {Escherichia coli [TaxId: 562]}
fgycescgveigirrlearptadlcidcktlaeirekqmag

SCOPe Domain Coordinates for d1tjli2:

Click to download the PDB-style file with coordinates for d1tjli2.
(The format of our PDB-style files is described here.)

Timeline for d1tjli2: