Lineage for d1tjlh1 (1tjl H:7-110)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 437311Fold a.2: Long alpha-hairpin [46556] (14 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 437652Superfamily a.2.14: DnaK suppressor protein DksA, alpha-hairpin domain [109635] (1 family) (S)
  5. 437653Family a.2.14.1: DnaK suppressor protein DksA, alpha-hairpin domain [109636] (1 protein)
  6. 437654Protein DnaK suppressor protein DksA, alpha-hairpin domain [109637] (1 species)
  7. 437655Species Escherichia coli [TaxId:562] [109638] (1 PDB entry)
  8. 437663Domain d1tjlh1: 1tjl H:7-110 [107041]
    Other proteins in same PDB: d1tjla2, d1tjlb2, d1tjlc2, d1tjld2, d1tjle2, d1tjlf2, d1tjlg2, d1tjlh2, d1tjli2, d1tjlj2

Details for d1tjlh1

PDB Entry: 1tjl (more details), 2 Å

PDB Description: Crystal structure of transcription factor DksA from E. coli

SCOP Domain Sequences for d1tjlh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tjlh1 a.2.14.1 (H:7-110) DnaK suppressor protein DksA, alpha-hairpin domain {Escherichia coli}
rktsslsilaiagvepyqekpgeeymneaqlahfrrileawrnqlrdevdrtvthmqdea
anfpdpvdraaqeeefslelrnrdrerklikkiektlkkveded

SCOP Domain Coordinates for d1tjlh1:

Click to download the PDB-style file with coordinates for d1tjlh1.
(The format of our PDB-style files is described here.)

Timeline for d1tjlh1: