![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.14: DnaK suppressor protein DksA, alpha-hairpin domain [109635] (1 family) ![]() |
![]() | Family a.2.14.1: DnaK suppressor protein DksA, alpha-hairpin domain [109636] (1 protein) |
![]() | Protein DnaK suppressor protein DksA, alpha-hairpin domain [109637] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [109638] (1 PDB entry) Uniprot P18274 7-151 |
![]() | Domain d1tjlh1: 1tjl H:7-110 [107041] Other proteins in same PDB: d1tjla2, d1tjlb2, d1tjlc2, d1tjld2, d1tjle2, d1tjlf2, d1tjlg2, d1tjlh2, d1tjli2, d1tjlj2 complexed with zn |
PDB Entry: 1tjl (more details), 2 Å
SCOPe Domain Sequences for d1tjlh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tjlh1 a.2.14.1 (H:7-110) DnaK suppressor protein DksA, alpha-hairpin domain {Escherichia coli [TaxId: 562]} rktsslsilaiagvepyqekpgeeymneaqlahfrrileawrnqlrdevdrtvthmqdea anfpdpvdraaqeeefslelrnrdrerklikkiektlkkveded
Timeline for d1tjlh1: