SCOPe 2.08: Domain d1tjlh1: 1tjl H:7-110

Lineage for d1tjlh1 (1tjl H:7-110)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.14: DnaK suppressor protein DksA, alpha-hairpin domain [109635] (1 family)

5. Family a.2.14.1: DnaK suppressor protein DksA, alpha-hairpin domain [109636] (1 protein)

6. Protein DnaK suppressor protein DksA, alpha-hairpin domain [109637] (1 species)

7. Species Escherichia coli [TaxId:562] [109638] (1 PDB entry)
   Uniprot P18274 7-151

8. Domain d1tjlh1: 1tjl H:7-110 [107041]
   Other proteins in same PDB: d1tjla2, d1tjlb2, d1tjlc2, d1tjld2, d1tjle2, d1tjlf2, d1tjlg2, d1tjlh2, d1tjli2, d1tjlj2
   complexed with zn

Details for d1tjlh1

PDB Entry: 1tjl, 2 Å

PDB Description: Crystal structure of transcription factor DksA from E. coli

PDB Compounds: (H:) DnaK suppressor protein

SCOPe Domain Sequences for d1tjlh1:

Sequence; same for both SEQRES and ATOM records:

>d1tjlh1 a.2.14.1 (H:7-110) DnaK suppressor protein DksA, alpha-hairpin domain {Escherichia coli [TaxId: 562]}
rktsslsilaiagvepyqekpgeeymneaqlahfrrileawrnqlrdevdrtvthmqdea
anfpdpvdraaqeeefslelrnrdrerklikkiektlkkveded

Timeline for d1tjlh1:

• d1tjlh1 first appeared in SCOP 1.69
  
• d1tjlh1 appears in SCOPe 2.07