Lineage for d1tjlf1 (1tjl F:7-110)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1979497Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1980270Superfamily a.2.14: DnaK suppressor protein DksA, alpha-hairpin domain [109635] (1 family) (S)
  5. 1980271Family a.2.14.1: DnaK suppressor protein DksA, alpha-hairpin domain [109636] (1 protein)
  6. 1980272Protein DnaK suppressor protein DksA, alpha-hairpin domain [109637] (1 species)
  7. 1980273Species Escherichia coli [TaxId:562] [109638] (1 PDB entry)
    Uniprot P18274 7-151
  8. 1980279Domain d1tjlf1: 1tjl F:7-110 [107037]
    Other proteins in same PDB: d1tjla2, d1tjlb2, d1tjlc2, d1tjld2, d1tjle2, d1tjlf2, d1tjlg2, d1tjlh2, d1tjli2, d1tjlj2
    complexed with zn

Details for d1tjlf1

PDB Entry: 1tjl (more details), 2 Å

PDB Description: Crystal structure of transcription factor DksA from E. coli
PDB Compounds: (F:) DnaK suppressor protein

SCOPe Domain Sequences for d1tjlf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tjlf1 a.2.14.1 (F:7-110) DnaK suppressor protein DksA, alpha-hairpin domain {Escherichia coli [TaxId: 562]}
rktsslsilaiagvepyqekpgeeymneaqlahfrrileawrnqlrdevdrtvthmqdea
anfpdpvdraaqeeefslelrnrdrerklikkiektlkkveded

SCOPe Domain Coordinates for d1tjlf1:

Click to download the PDB-style file with coordinates for d1tjlf1.
(The format of our PDB-style files is described here.)

Timeline for d1tjlf1: