SCOP 1.69: Domain d1tjlc2: 1tjl C:111-151

Lineage for d1tjlc2 (1tjl C:111-151)

1. Root: SCOP 1.69

2. Class g: Small proteins [56992] (75 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (13 families)

5. Family g.39.1.13: Prokaryotic DksA/TraR C4-type zinc finger (Pfam 01258) [111448] (1 protein)
   Pfam coverage extends to the second helix of the upstream alpha-hairpin domain

6. Protein DnaK suppressor protein DksA, zinc finger domain [111449] (1 species)

7. Species Escherichia coli [TaxId:562] [111450] (1 PDB entry)

8. Domain d1tjlc2: 1tjl C:111-151 [107032]
   Other proteins in same PDB: d1tjla1, d1tjlb1, d1tjlc1, d1tjld1, d1tjle1, d1tjlf1, d1tjlg1, d1tjlh1, d1tjli1, d1tjlj1

Details for d1tjlc2

PDB Entry: 1tjl, 2 Å

PDB Description: Crystal structure of transcription factor DksA from E. coli

SCOP Domain Sequences for d1tjlc2:

Sequence; same for both SEQRES and ATOM records:

>d1tjlc2 g.39.1.13 (C:111-151) DnaK suppressor protein DksA, zinc finger domain {Escherichia coli}
fgycescgveigirrlearptadlcidcktlaeirekqmag

Timeline for d1tjlc2:

• d1tjlc2 is new in SCOP 1.69
  
• d1tjlc2 appears in SCOP 1.71
  
• d1tjlc2 appears in the current release, SCOPe 2.08