Lineage for d1tjka_ (1tjk A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 544466Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 544467Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 544472Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 544553Protein Snake phospholipase A2 [48624] (35 species)
  7. 544702Species Snake (Daboia russelli pulchella), different isoforms [48630] (26 PDB entries)
  8. 544711Domain d1tjka_: 1tjk A: [107026]
    complexed with so4

Details for d1tjka_

PDB Entry: 1tjk (more details), 1.25 Å

PDB Description: crystal structure of the complex formed between group ii phospholipase a2 with a designed pentapeptide, phe- leu- ser- thr- lys at 1.2 a resolution

SCOP Domain Sequences for d1tjka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tjka_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Daboia russelli pulchella), different isoforms}
sllefgkmileetgklaipsyssygcycgwggsgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

SCOP Domain Coordinates for d1tjka_:

Click to download the PDB-style file with coordinates for d1tjka_.
(The format of our PDB-style files is described here.)

Timeline for d1tjka_: