SCOPe 2.08: Domain d1tjah_: 1tja H:

Lineage for d1tjah_ (1tja H:)

1. Root: SCOPe 2.08

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.19: Bacteriophage T4 3D cryo-EM reconstruction [103674] (1 superfamily)

4. Superfamily i.19.1: Bacteriophage T4 3D cryo-EM reconstruction [103675] (1 family)

5. Family i.19.1.1: Bacteriophage T4 3D cryo-EM reconstruction [103676] (1 protein)

6. Protein Bacteriophage T4 3D cryo-EM reconstruction [103677] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [103678] (7 PDB entries)

8. Domain d1tjah_: 1tja H: [107023]

Details for d1tjah_

PDB Entry: 1tja

PDB Description: fitting of gp8, gp9, and gp11 into the cryo-em reconstruction of the bacteriophage t4 contracted tail

PDB Compounds: (H:) baseplate structural protein gp11

SCOPe Domain Sequences for d1tjah_:

Sequence; same for both SEQRES and ATOM records:

>d1tjah_ i.19.1.1 (H:) Bacteriophage T4 3D cryo-EM reconstruction {Bacteriophage T4 [TaxId: 10665]}
srladflgfrpktgdidvmnrqsvgsvtisqlakgfyepniesaindvhnfsikdvgtii
tnktgvspegvsqtdywafsgtvtddslppgspitvlvfglpvsattgmtaiefvakvrv
alqeaiasftainsykdhptdgsklevtyldnqkhvlstystygitisqeiiseskpgyg
twnllgaqtvtldnqqtptvfyhferta

Timeline for d1tjah_:

• d1tjah_ first appeared in SCOP 1.69
  
• d1tjah_ appears in SCOPe 2.07