Lineage for d1tjab_ (1tja B:)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2650010Fold i.19: Bacteriophage T4 3D cryo-EM reconstruction [103674] (1 superfamily)
  4. 2650011Superfamily i.19.1: Bacteriophage T4 3D cryo-EM reconstruction [103675] (1 family) (S)
  5. 2650012Family i.19.1.1: Bacteriophage T4 3D cryo-EM reconstruction [103676] (1 protein)
  6. 2650013Protein Bacteriophage T4 3D cryo-EM reconstruction [103677] (1 species)
  7. 2650014Species Bacteriophage T4 [TaxId:10665] [103678] (7 PDB entries)
  8. 2650088Domain d1tjab_: 1tja B: [107017]

Details for d1tjab_

PDB Entry: 1tja (more details), 16 Å

PDB Description: fitting of gp8, gp9, and gp11 into the cryo-em reconstruction of the bacteriophage t4 contracted tail
PDB Compounds: (B:) baseplate structural protein gp8

SCOPe Domain Sequences for d1tjab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tjab_ i.19.1.1 (B:) Bacteriophage T4 3D cryo-EM reconstruction {Bacteriophage T4 [TaxId: 10665]}
iyraivtskfrtekmlnfynsigsgpdkntifitfgrsepwssnenevgfappyptdsvl
gvtdmwthmmgtvkvlpsmldaviprrdwgdtrypdpytfrindivvcnsapynatesga
gwlvyrcldvpdtgmcsiasltdkdeclklggkwtpsarsmtppegrgdaegtiepgdgy
vweylfeippdvsinrctneyivvpwpeelkedptrwgyednltwqqddfgliyrvkant
irfkayldsvyfpeaalpgnkgfrqisiitnpleakahpndpnvkaekdyydpedlmrhs
gemiymenrppiimamdqteeinilftf

SCOPe Domain Coordinates for d1tjab_:

Click to download the PDB-style file with coordinates for d1tjab_.
(The format of our PDB-style files is described here.)

Timeline for d1tjab_: