Lineage for d1tjaa_ (1tja A:)

  1. Root: SCOP 1.69
  2. 526321Class i: Low resolution protein structures [58117] (24 folds)
  3. 528132Fold i.19: Bacteriophage T4 3D cryo-EM reconstruction [103674] (1 superfamily)
  4. 528133Superfamily i.19.1: Bacteriophage T4 3D cryo-EM reconstruction [103675] (1 family) (S)
  5. 528134Family i.19.1.1: Bacteriophage T4 3D cryo-EM reconstruction [103676] (1 protein)
  6. 528135Protein Bacteriophage T4 3D cryo-EM reconstruction [103677] (1 species)
  7. 528136Species Bacteriophage T4 [TaxId:10665] [103678] (7 PDB entries)
  8. 528209Domain d1tjaa_: 1tja A: [107016]

Details for d1tjaa_

PDB Entry: 1tja (more details)

PDB Description: fitting of gp8, gp9, and gp11 into the cryo-em reconstruction of the bacteriophage t4 contracted tail

SCOP Domain Sequences for d1tjaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tjaa_ i.19.1.1 (A:) Bacteriophage T4 3D cryo-EM reconstruction {Bacteriophage T4}
iyraivtskfrtekmlnfynsigsgpdkntifitfgrsepwssnenevgfappyptdsvl
gvtdmwthmmgtvkvlpsmldaviprrdwgdtrypdpytfrindivvcnsapynatesga
gwlvyrcldvpdtgmcsiasltdkdeclklggkwtpsarsmtppegrgdaegtiepgdgy
vweylfeippdvsinrctneyivvpwpeelkedptrwgyednltwqqddfgliyrvkant
irfkayldsvyfpeaalpgnkgfrqisiitnpleakahpndpnvkaekdyydpedlmrhs
gemiymenrppiimamdqteeinilftf

SCOP Domain Coordinates for d1tjaa_:

Click to download the PDB-style file with coordinates for d1tjaa_.
(The format of our PDB-style files is described here.)

Timeline for d1tjaa_: