SCOPe 2.05: Domain d1tj9a_: 1tj9 A:

Lineage for d1tj9a_ (1tj9 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein Snake phospholipase A2 [48624] (36 species)

7. Species Snake (Daboia russellii pulchella), different isoforms [TaxId:97228] [48630] (35 PDB entries)
   Uniprot P59071

8. Domain d1tj9a_: 1tj9 A: [107015]
   complexed with acy, so4

Details for d1tj9a_

PDB Entry: 1tj9, 1.1 Å

PDB Description: structure of the complexed formed between group ii phospholipase a2 and a rationally designed tetra peptide,val-ala-arg-ser at 1.1a resolution

PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d1tj9a_:

Sequence; same for both SEQRES and ATOM records:

>d1tj9a_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

Timeline for d1tj9a_:

• d1tj9a_ first appeared in SCOP 1.69
  
• d1tj9a_ appears in SCOPe 2.04
  
• d1tj9a_ appears in SCOPe 2.06
  
• d1tj9a_ appears in the current release, SCOPe 2.08