SCOPe 2.08: Domain d1tiza1: 1tiz A:2-67

Lineage for d1tiza1 (1tiz A:2-67)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Calmodulin-related protein T21P5.17 [109823] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [109824] (1 PDB entry)
   Uniprot Q9SRP5 2-67

8. Domain d1tiza1: 1tiz A:2-67 [107014]
   Other proteins in same PDB: d1tiza2
   N-domain only
   fragment; missing more than one-third of the common structure and/or sequence

Details for d1tiza1

PDB Entry: 1tiz

PDB Description: solution structure of a calmodulin-like calcium-binding domain from arabidopsis thaliana

PDB Compounds: (A:) calmodulin-related protein, putative

SCOPe Domain Sequences for d1tiza1:

Sequence; same for both SEQRES and ATOM records:

>d1tiza1 a.39.1.5 (A:2-67) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sakrvfekfdknkdgklsldefrevalafspyftqedivkffeeidvdgngelnadefts
ciekml

Timeline for d1tiza1:

• d1tiza1 first appeared in SCOP 1.69, called d1tiza_
  
• d1tiza1 appears in SCOPe 2.07