Lineage for d1tiza1 (1tiz A:2-67)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1994319Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1994320Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1994753Family a.39.1.5: Calmodulin-like [47502] (24 protein domains)
    Duplication: made with two pairs of EF-hands
  6. 1995109Protein Calmodulin-related protein T21P5.17 [109823] (1 species)
  7. 1995110Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [109824] (1 PDB entry)
    Uniprot Q9SRP5 2-67
  8. 1995111Domain d1tiza1: 1tiz A:2-67 [107014]
    Other proteins in same PDB: d1tiza2
    N-domain only

Details for d1tiza1

PDB Entry: 1tiz (more details)

PDB Description: Solution Structure of a Calmodulin-Like Calcium-Binding Domain from Arabidopsis thaliana
PDB Compounds: (A:) calmodulin-related protein, putative

SCOPe Domain Sequences for d1tiza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tiza1 a.39.1.5 (A:2-67) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sakrvfekfdknkdgklsldefrevalafspyftqedivkffeeidvdgngelnadefts
ciekml

SCOPe Domain Coordinates for d1tiza1:

Click to download the PDB-style file with coordinates for d1tiza1.
(The format of our PDB-style files is described here.)

Timeline for d1tiza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tiza2