| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) ![]() contains extra C-terminal strand 5, order 21345 |
| Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins) strand 5 is parallel to strand 4 |
| Protein Guanine deaminase GuaD [110765] (1 species) |
| Species Bacillus subtilis [TaxId:1423] [110766] (2 PDB entries) Uniprot O34598 |
| Domain d1tiyb_: 1tiy B: [107013] Other proteins in same PDB: d1tiya2 Structural genomics target complexed with zn |
PDB Entry: 1tiy (more details), 2.5 Å
SCOPe Domain Sequences for d1tiyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tiyb_ c.97.1.2 (B:) Guanine deaminase GuaD {Bacillus subtilis [TaxId: 1423]}
mnhetflkravtlacegvnagiggpfgavivkdgaiiaegqnnvttsndptahaevtair
kackvlgayqlddcilytscepcpmclgaiywarpkavfyaaehtdaaeagfddsfiyke
idkpaeertipfyqvtltehlspfqawrnf
Timeline for d1tiyb_: