Lineage for d1tiya_ (1tiy A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 495641Fold c.97: Cytidine deaminase-like [53926] (3 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 2 is antiparallel to the rest
  4. 495642Superfamily c.97.1: Cytidine deaminase-like [53927] (2 families) (S)
  5. 495674Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (2 proteins)
  6. 495685Protein Guanine deaminase GuaD [110765] (1 species)
  7. 495686Species Bacillus subtilis [TaxId:1423] [110766] (2 PDB entries)
  8. 495689Domain d1tiya_: 1tiy A: [107012]

Details for d1tiya_

PDB Entry: 1tiy (more details), 2.5 Å

PDB Description: x-ray structure of guanine deaminase from bacillus subtilis northeast structural genomics consortium target sr160

SCOP Domain Sequences for d1tiya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tiya_ c.97.1.2 (A:) Guanine deaminase GuaD {Bacillus subtilis}
mnhetflkravtlacegvnagiggpfgavivkdgaiiaegqnnvttsndptahaevtair
kackvlgayqlddcilytscepcpmclgaiywarpkavfyaaehtdaaeagfddsfiyke
idkpaeertipfyqvtltehlspfqawrnfankkeyl

SCOP Domain Coordinates for d1tiya_:

Click to download the PDB-style file with coordinates for d1tiya_.
(The format of our PDB-style files is described here.)

Timeline for d1tiya_: