Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (5 families) |
Family d.108.1.1: N-acetyl transferase, NAT [55730] (20 proteins) |
Protein Protease synthase and sporulation negative regulatory protein PaiA [111100] (1 species) |
Species Bacillus subtilis [TaxId:1423] [111101] (1 PDB entry) |
Domain d1tiqb_: 1tiq B: [107011] Structural genomics target |
PDB Entry: 1tiq (more details), 1.9 Å
SCOP Domain Sequences for d1tiqb_:
Sequence, based on SEQRES records: (download)
>d1tiqb_ d.108.1.1 (B:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis} svkmkkcsredlqtlqqlsietfndtfkeqnspenmkaylesafnteqlekelsnmssqf ffiyfdheiagyvkvniddaqseemgaesleieriyiknsfqkhglgkhllnkaieiale rnkkniwlgvweknenaiafykkmgfvqtgahsfymgdeeqtdlimaktlilehhh
>d1tiqb_ d.108.1.1 (B:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis} svkmkkcsredlqtlqqlsietfndenmkaylesafnteqlekelsnmssqfffiyfdhe iagyvkvniddaqseemgaesleieriyiknsfqkhglgkhllnkaieialernkkniwl gvweknenaiafykkmgfvqtgahsfymgdeeqtdlimaktlilehhh
Timeline for d1tiqb_: