SCOPe 2.08: Domain d1tiqb1: 1tiq B:2-172

Lineage for d1tiqb1 (1tiq B:2-172)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)

6. Protein Protease synthase and sporulation negative regulatory protein PaiA [111100] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [111101] (1 PDB entry)
   Uniprot P21340

8. Domain d1tiqb1: 1tiq B:2-172 [107011]
   Other proteins in same PDB: d1tiqa2, d1tiqb2
   Structural genomics target
   complexed with coa, dtt, so4

Details for d1tiqb1

PDB Entry: 1tiq, 1.9 Å

PDB Description: crystal structure of an acetyltransferase (paia) in complex with coa and dtt from bacillus subtilis, northeast structural genomics target sr64.

PDB Compounds: (B:) Protease synthase and sporulation negative regulatory protein PAI 1

SCOPe Domain Sequences for d1tiqb1:

Sequence, based on SEQRES records:

>d1tiqb1 d.108.1.1 (B:2-172) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]}
svkmkkcsredlqtlqqlsietfndtfkeqnspenmkaylesafnteqlekelsnmssqf
ffiyfdheiagyvkvniddaqseemgaesleieriyiknsfqkhglgkhllnkaieiale
rnkkniwlgvweknenaiafykkmgfvqtgahsfymgdeeqtdlimaktli

Sequence, based on observed residues (ATOM records):

>d1tiqb1 d.108.1.1 (B:2-172) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]}
svkmkkcsredlqtlqqlsietfndenmkaylesafnteqlekelsnmssqfffiyfdhe
iagyvkvniddaqseemgaesleieriyiknsfqkhglgkhllnkaieialernkkniwl
gvweknenaiafykkmgfvqtgahsfymgdeeqtdlimaktli

Timeline for d1tiqb1:

• d1tiqb1 first appeared in SCOP 1.69, called d1tiqb_
  
• d1tiqb1 appears in SCOPe 2.07