Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.13: SpoIIaa-like [52086] (2 superfamilies) core: 4 turns of a (beta-alpha)n superhelix |
Superfamily c.13.2: SpoIIaa-like [52091] (2 families) |
Family c.13.2.1: Anti-sigma factor antagonist SpoIIaa [52092] (1 protein) automatically mapped to Pfam PF01740 |
Protein Anti-sigma factor antagonist SpoIIaa [52093] (4 species) |
Species Bacillus stearothermophilus [TaxId:1422] [110448] (4 PDB entries) Uniprot O32726 # 90% sequence identity |
Domain d1tilf1: 1til F:1-116 [107009] Other proteins in same PDB: d1tila_, d1tilb2, d1tilc_, d1tild2, d1tile_, d1tilf2 complexed with atp, mg |
PDB Entry: 1til (more details), 2.7 Å
SCOPe Domain Sequences for d1tilf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tilf1 c.13.2.1 (F:1-116) Anti-sigma factor antagonist SpoIIaa {Bacillus stearothermophilus [TaxId: 1422]} mslaidlevkqdvlivrlsgeldhhtaeelreqvtdvlenrairhivlnlgqltfmdasg lgvilgrykqiknvggqmvvcavspavkrlfdmsglfkiirveadeqfalqalgva
Timeline for d1tilf1: