Lineage for d1tilc_ (1til C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2579776Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2579777Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2580397Family d.122.1.3: Histidine kinase [55884] (8 proteins)
  6. 2580398Protein Anti-sigma factor spoIIab [75535] (1 species)
  7. 2580399Species Bacillus stearothermophilus [TaxId:1422] [75536] (5 PDB entries)
    Uniprot O32727
  8. 2580406Domain d1tilc_: 1til C: [107006]
    Other proteins in same PDB: d1tilb1, d1tilb2, d1tild1, d1tild2, d1tilf1, d1tilf2
    complexed with atp, mg

Details for d1tilc_

PDB Entry: 1til (more details), 2.7 Å

PDB Description: crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa:poised for phosphorylation complex with atp, crystal form ii
PDB Compounds: (C:) Anti-sigma F factor

SCOPe Domain Sequences for d1tilc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tilc_ d.122.1.3 (C:) Anti-sigma factor spoIIab {Bacillus stearothermophilus [TaxId: 1422]}
mrnemhlqfsarsenesfarvtvaafvaqldptmdelteiktvvseavtnaiihgynndp
ngivsisviiedgvvhltvrdegvgipdieearqplfttkpelersgmgftimenfmdev
ivesevnkgttvylkkhivks

SCOPe Domain Coordinates for d1tilc_:

Click to download the PDB-style file with coordinates for d1tilc_.
(The format of our PDB-style files is described here.)

Timeline for d1tilc_: