![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
![]() | Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) ![]() |
![]() | Family d.122.1.3: Histidine kinase [55884] (5 proteins) |
![]() | Protein Anti-sigma factor spoIIab [75535] (1 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [75536] (5 PDB entries) |
![]() | Domain d1tilc_: 1til C: [107006] Other proteins in same PDB: d1tilb_, d1tild_, d1tilf_ |
PDB Entry: 1til (more details), 2.7 Å
SCOP Domain Sequences for d1tilc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tilc_ d.122.1.3 (C:) Anti-sigma factor spoIIab {Bacillus stearothermophilus} mrnemhlqfsarsenesfarvtvaafvaqldptmdelteiktvvseavtnaiihgynndp ngivsisviiedgvvhltvrdegvgipdieearqplfttkpelersgmgftimenfmdev ivesevnkgttvylkkhivks
Timeline for d1tilc_: