Lineage for d1tika_ (1tik A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 578575Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 578848Superfamily c.23.5: Flavoproteins [52218] (8 families) (S)
  5. 578955Family c.23.5.3: Quinone reductase [52235] (3 proteins)
    binds FAD
  6. 578956Protein ACP phosphodiesterase AcpD [110470] (2 species)
    evolved new enzymatic activity
  7. 578957Species Escherichia coli [TaxId:562] [110471] (1 PDB entry)
  8. 578958Domain d1tika_: 1tik A: [107003]
    Structural genomics target
    complexed with so4

Details for d1tika_

PDB Entry: 1tik (more details), 2.3 Å

PDB Description: crystal structure of acyl carrier protein phosphodiesterase

SCOP Domain Sequences for d1tika_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tika_ c.23.5.3 (A:) ACP phosphodiesterase AcpD {Escherichia coli}
slskvlvlkssilagysqsnqlsdyfveqwrekhsadeitvrdlaanpipvldgelvgal
rpsdapltprqqealalsdeliaelkahdviviaapmynfnistqlknyfdlvaragvtf
rytengpeglvtgkkaivitsrggihkdgptdlvtpylstflgfigitdvkfvfaegiay
gpemaakaqsdakaaidsivsae

SCOP Domain Coordinates for d1tika_:

Click to download the PDB-style file with coordinates for d1tika_.
(The format of our PDB-style files is described here.)

Timeline for d1tika_: